Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.129: TBP-like [55944] (4 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (4 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.3: Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55969] (1 protein) contains a few insertion and C-terminal extension compared with Bet v1 |
Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (1 species) |
Species Pseudomonas putida [TaxId:303] [55971] (8 PDB entries) |
Domain d1ndoe2: 1ndo E:155-445 [41325] Other proteins in same PDB: d1ndoa1, d1ndob_, d1ndoc1, d1ndod_, d1ndoe1, d1ndof_ complexed with fe, fes |
PDB Entry: 1ndo (more details), 2.25 Å
SCOP Domain Sequences for d1ndoe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndoe2 d.129.3.3 (E:155-445) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida} eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltk
Timeline for d1ndoe2: