Lineage for d1eg9a2 (1eg9 A:155-447)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926476Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 1926508Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)
  7. 1926509Species Pseudomonas putida [TaxId:303] [55971] (10 PDB entries)
  8. 1926511Domain d1eg9a2: 1eg9 A:155-447 [41322]
    Other proteins in same PDB: d1eg9a1, d1eg9b_
    complexed with fe, fes, ind, so4

Details for d1eg9a2

PDB Entry: 1eg9 (more details), 1.6 Å

PDB Description: naphthalene 1,2-dioxygenase with indole bound in the active site.
PDB Compounds: (A:) protein (naphthalene 1,2-dioxygenase alpha subunit)

SCOPe Domain Sequences for d1eg9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg9a2 d.129.3.3 (A:155-447) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltktt

SCOPe Domain Coordinates for d1eg9a2:

Click to download the PDB-style file with coordinates for d1eg9a2.
(The format of our PDB-style files is described here.)

Timeline for d1eg9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eg9a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1eg9b_