Lineage for d1eg9a2 (1eg9 A:155-447)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35720Fold d.129: TBP-like [55944] (3 superfamilies)
  4. 35838Superfamily d.129.3: Bet v1-like [55961] (3 families) (S)
  5. 35855Family d.129.3.3: Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55969] (1 protein)
  6. 35856Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (1 species)
  7. 35857Species Pseudomonas putida [TaxId:303] [55971] (2 PDB entries)
  8. 35858Domain d1eg9a2: 1eg9 A:155-447 [41322]
    Other proteins in same PDB: d1eg9a1, d1eg9b_

Details for d1eg9a2

PDB Entry: 1eg9 (more details), 1.6 Å

PDB Description: naphthalene 1,2-dioxygenase with indole bound in the active site.

SCOP Domain Sequences for d1eg9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg9a2 d.129.3.3 (A:155-447) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltktt

SCOP Domain Coordinates for d1eg9a2:

Click to download the PDB-style file with coordinates for d1eg9a2.
(The format of our PDB-style files is described here.)

Timeline for d1eg9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eg9a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1eg9b_