Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.129: TBP-like [55944] (7 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (4 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.2: STAR domain [55966] (3 proteins) |
Protein Lipid transport domain of Mln64 [55967] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55968] (1 PDB entry) |
Domain d1em2a_: 1em2 A: [41321] complexed with tar; mutant |
PDB Entry: 1em2 (more details), 2.2 Å
SCOP Domain Sequences for d1em2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens)} sfsaqereyirqgkeatavvdqilaqeenwkfeknneygdtvytievpfhgktfilktfl pcpaelvyqevilqpermvlwnktvtacqilqrvedntlisydvsagaaggvvsprdfvn vrrierrrdrylssgiatshsakppthkyvrgengpggmivlksasnprvctfvwilntd lkgrlprylihqslaatmfefafhlrqriselga
Timeline for d1em2a_: