Lineage for d1em2a_ (1em2 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418216Fold d.129: TBP-like [55944] (7 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 418378Superfamily d.129.3: Bet v1-like [55961] (4 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 418406Family d.129.3.2: STAR domain [55966] (3 proteins)
  6. 418411Protein Lipid transport domain of Mln64 [55967] (1 species)
  7. 418412Species Human (Homo sapiens) [TaxId:9606] [55968] (1 PDB entry)
  8. 418413Domain d1em2a_: 1em2 A: [41321]
    complexed with tar; mutant

Details for d1em2a_

PDB Entry: 1em2 (more details), 2.2 Å

PDB Description: star-related lipid transport domain of mln64

SCOP Domain Sequences for d1em2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens)}
sfsaqereyirqgkeatavvdqilaqeenwkfeknneygdtvytievpfhgktfilktfl
pcpaelvyqevilqpermvlwnktvtacqilqrvedntlisydvsagaaggvvsprdfvn
vrrierrrdrylssgiatshsakppthkyvrgengpggmivlksasnprvctfvwilntd
lkgrlprylihqslaatmfefafhlrqriselga

SCOP Domain Coordinates for d1em2a_:

Click to download the PDB-style file with coordinates for d1em2a_.
(The format of our PDB-style files is described here.)

Timeline for d1em2a_: