Lineage for d1em2a_ (1em2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975647Family d.129.3.2: STAR domain [55966] (5 proteins)
    automatically mapped to Pfam PF01852
  6. 2975652Protein Lipid transport domain of Mln64 [55967] (1 species)
  7. 2975653Species Human (Homo sapiens) [TaxId:9606] [55968] (1 PDB entry)
  8. 2975654Domain d1em2a_: 1em2 A: [41321]
    complexed with tar

Details for d1em2a_

PDB Entry: 1em2 (more details), 2.2 Å

PDB Description: star-related lipid transport domain of mln64
PDB Compounds: (A:) mln64 protein

SCOPe Domain Sequences for d1em2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]}
sfsaqereyirqgkeatavvdqilaqeenwkfeknneygdtvytievpfhgktfilktfl
pcpaelvyqevilqpermvlwnktvtacqilqrvedntlisydvsagaaggvvsprdfvn
vrrierrrdrylssgiatshsakppthkyvrgengpggmivlksasnprvctfvwilntd
lkgrlprylihqslaatmfefafhlrqriselga

SCOPe Domain Coordinates for d1em2a_:

Click to download the PDB-style file with coordinates for d1em2a_.
(The format of our PDB-style files is described here.)

Timeline for d1em2a_: