![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.2: STAR domain [55966] (5 proteins) automatically mapped to Pfam PF01852 |
![]() | Protein Lipid transport domain of Mln64 [55967] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55968] (1 PDB entry) |
![]() | Domain d1em2a_: 1em2 A: [41321] complexed with tar |
PDB Entry: 1em2 (more details), 2.2 Å
SCOPe Domain Sequences for d1em2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} sfsaqereyirqgkeatavvdqilaqeenwkfeknneygdtvytievpfhgktfilktfl pcpaelvyqevilqpermvlwnktvtacqilqrvedntlisydvsagaaggvvsprdfvn vrrierrrdrylssgiatshsakppthkyvrgengpggmivlksasnprvctfvwilntd lkgrlprylihqslaatmfefafhlrqriselga
Timeline for d1em2a_: