Lineage for d1fskj_ (1fsk J:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35720Fold d.129: TBP-like [55944] (3 superfamilies)
  4. 35838Superfamily d.129.3: Bet v1-like [55961] (3 families) (S)
  5. 35839Family d.129.3.1: Major birch pollen allergen Bet v 1 [55962] (1 protein)
  6. 35840Protein Major birch pollen allergen Bet v 1 [55963] (2 species)
  7. 35841Species European white birch (Betula pendula) [55965] (1 PDB entry)
  8. 35845Domain d1fskj_: 1fsk J: [41320]
    Other proteins in same PDB: d1fskb1, d1fskb2, d1fskc1, d1fskc2, d1fske1, d1fske2, d1fskf1, d1fskf2, d1fskh1, d1fskh2, d1fski1, d1fski2, d1fskk1, d1fskk2, d1fskl1, d1fskl2

Details for d1fskj_

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

SCOP Domain Sequences for d1fskj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fskj_ d.129.3.1 (J:) Major birch pollen allergen Bet v 1 {European white birch (Betula pendula)}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOP Domain Coordinates for d1fskj_:

Click to download the PDB-style file with coordinates for d1fskj_.
(The format of our PDB-style files is described here.)

Timeline for d1fskj_: