Lineage for d1fskg_ (1fsk G:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83826Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 83947Superfamily d.129.3: Bet v1-like [55961] (4 families) (S)
  5. 83948Family d.129.3.1: Major tree pollen allergen [55962] (1 protein)
  6. 83949Protein Major tree pollen allergen [55963] (3 species)
  7. 83950Species European white birch (Betula pendula), Bet v I-a [TaxId:3505] [55965] (1 PDB entry)
  8. 83953Domain d1fskg_: 1fsk G: [41319]
    Other proteins in same PDB: d1fskb1, d1fskb2, d1fskc1, d1fskc2, d1fske1, d1fske2, d1fskf1, d1fskf2, d1fskh1, d1fskh2, d1fski1, d1fski2, d1fskk1, d1fskk2, d1fskl1, d1fskl2

Details for d1fskg_

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

SCOP Domain Sequences for d1fskg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fskg_ d.129.3.1 (G:) Major tree pollen allergen {European white birch (Betula pendula), Bet v I-a}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOP Domain Coordinates for d1fskg_:

Click to download the PDB-style file with coordinates for d1fskg_.
(The format of our PDB-style files is described here.)

Timeline for d1fskg_: