![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.129: TBP-like [55944] (10 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (7 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins) |
![]() | Protein Major tree pollen allergen [55963] (4 species) |
![]() | Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (5 PDB entries) |
![]() | Domain d1b6fa_: 1b6f A: [41316] |
PDB Entry: 1b6f (more details)
SCOP Domain Sequences for d1b6fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6fa_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]} gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky htkgdhevkaeqvkaskelgetllravesyllahsdayn
Timeline for d1b6fa_: