Lineage for d1qmra_ (1qmr A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872733Superfamily d.129.3: Bet v1-like [55961] (10 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 872734Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)
  6. 872745Protein Major tree pollen allergen [55963] (4 species)
  7. 872756Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (5 PDB entries)
  8. 872757Domain d1qmra_: 1qmr A: [41314]
    mutant

Details for d1qmra_

PDB Entry: 1qmr (more details), 2.15 Å

PDB Description: birch pollen allergen bet v 1 mutant n28t, k32q, e45s, p108g
PDB Compounds: (A:) major pollen allergen bet v 1-a

SCOP Domain Sequences for d1qmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmra_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildgdtlfpqvapqaissvenisgnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatgdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOP Domain Coordinates for d1qmra_:

Click to download the PDB-style file with coordinates for d1qmra_.
(The format of our PDB-style files is described here.)

Timeline for d1qmra_: