Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Bacillus cereus [TaxId:222523] [419839] (2 PDB entries) |
Domain d3dula_: 3dul A: [413133] automated match to d7cvxa_ |
PDB Entry: 3dul (more details), 1.8 Å
SCOPe Domain Sequences for d3dula_:
Sequence, based on SEQRES records: (download)
>d3dula_ c.66.1.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]} twtavdqyvsdvlipkdstleevlqvnaaanlpahdvsptqgkflqllvqiqgarnilei gtlggystiwlarglssggrvvtleasekhadiarsnieranlndrvevrtglaldslqq ienekyepfdfifidadkqnnpayfewalklsrpgtviigdnvvregevidntsndprvq girrfyeliaaeprvsatalqtvgskgydgfimavvk
>d3dula_ c.66.1.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]} twtavdqyvsdvlipkdstleevlqvnaaanlpahdvsptqgkflqllvqiqgarnilei gtlggystiwlarglssggrvvtleasekhadiarsnieranlndrvevrtglaldslqq ienekyepfdfifidadkqnnpayfewalklsrpgtviigdnvvrirrfyeliaaeprvs atalqtvgskgydgfimavvk
Timeline for d3dula_: