Lineage for d3dula_ (3dul A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894506Species Bacillus cereus [TaxId:222523] [419839] (2 PDB entries)
  8. 2894509Domain d3dula_: 3dul A: [413133]
    automated match to d7cvxa_

Details for d3dula_

PDB Entry: 3dul (more details), 1.8 Å

PDB Description: Crystal Structure Analysis of the O-methyltransferase from Bacillus cereus
PDB Compounds: (A:) O-methyltransferase, putative

SCOPe Domain Sequences for d3dula_:

Sequence, based on SEQRES records: (download)

>d3dula_ c.66.1.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]}
twtavdqyvsdvlipkdstleevlqvnaaanlpahdvsptqgkflqllvqiqgarnilei
gtlggystiwlarglssggrvvtleasekhadiarsnieranlndrvevrtglaldslqq
ienekyepfdfifidadkqnnpayfewalklsrpgtviigdnvvregevidntsndprvq
girrfyeliaaeprvsatalqtvgskgydgfimavvk

Sequence, based on observed residues (ATOM records): (download)

>d3dula_ c.66.1.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]}
twtavdqyvsdvlipkdstleevlqvnaaanlpahdvsptqgkflqllvqiqgarnilei
gtlggystiwlarglssggrvvtleasekhadiarsnieranlndrvevrtglaldslqq
ienekyepfdfifidadkqnnpayfewalklsrpgtviigdnvvrirrfyeliaaeprvs
atalqtvgskgydgfimavvk

SCOPe Domain Coordinates for d3dula_:

Click to download the PDB-style file with coordinates for d3dula_.
(The format of our PDB-style files is described here.)

Timeline for d3dula_:

  • d3dula_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d3dulb_