Lineage for d1bv1a_ (1bv1 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040549Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1040550Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 1040560Protein Major tree pollen allergen [55963] (4 species)
  7. 1040571Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (5 PDB entries)
  8. 1040572Domain d1bv1a_: 1bv1 A: [41313]

Details for d1bv1a_

PDB Entry: 1bv1 (more details), 2 Å

PDB Description: birch pollen allergen bet v 1
PDB Compounds: (A:) bet v 1

SCOPe Domain Sequences for d1bv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bv1a_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOPe Domain Coordinates for d1bv1a_:

Click to download the PDB-style file with coordinates for d1bv1a_.
(The format of our PDB-style files is described here.)

Timeline for d1bv1a_: