Lineage for d3cfsb_ (3cfs B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2808918Family b.69.4.1: WD40-repeat [50979] (17 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2809096Protein automated matches [190346] (4 species)
    not a true protein
  7. 2809118Species Human (Homo sapiens) [TaxId:9606] [311290] (6 PDB entries)
  8. 2809124Domain d3cfsb_: 3cfs B: [413104]
    automated match to d3c99a_
    protein/DNA complex; complexed with ars

Details for d3cfsb_

PDB Entry: 3cfs (more details), 2.4 Å

PDB Description: structural basis of the interaction of rbap46/rbap48 with histone h4
PDB Compounds: (B:) Histone-binding protein RBBP7

SCOPe Domain Sequences for d3cfsb_:

Sequence, based on SEQRES records: (download)

>d3cfsb_ b.69.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fedtveervineeykiwkkntpflydlvmthalqwpsltvqwlpevtkpegkdyalhwlv
lgthtsdeqnhlvvarvhipnddaqfdashcdsdkgefggfgsvtgkieceikinhegev
nrarympqnphiiatktpssdvlvfdytkhpakpdpsgecnpdlrlrghqkegyglswns
nlsghllsasddhtvclwdinagpkegkivdakaiftghsavvedvawhllheslfgsva
ddqklmiwdtrsnttskpshlvdahtaevnclsfnpysefilatgsadktvalwdlrnlk
lklhtfeshkdeifqvhwsphnetilassgtdrrlnvwdlskigeeqsaedaedgppell
fihgghtakisdfswnpnepwvicsvsednimqiwqmaeniynd

Sequence, based on observed residues (ATOM records): (download)

>d3cfsb_ b.69.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fedtveervineeykiwkkntpflydlvmthalqwpsltvqwlpevtkpegkdyalhwlv
lgthtsdeqnhlvvarvhipnddtgkieceikinhegevnrarympqnphiiatktpssd
vlvfdytkhpakpdpsgecnpdlrlrghqkegyglswnsnlsghllsasddhtvclwdin
agpkegkivdakaiftghsavvedvawhllheslfgsvaddqklmiwdtrsnttskpshl
vdahtaevnclsfnpysefilatgsadktvalwdlrnlklklhtfeshkdeifqvhwsph
netilassgtdrrlnvwdlskigeeqsaedaedgppellfihgghtakisdfswnpnepw
vicsvsednimqiwqmaeniynd

SCOPe Domain Coordinates for d3cfsb_:

Click to download the PDB-style file with coordinates for d3cfsb_.
(The format of our PDB-style files is described here.)

Timeline for d3cfsb_:

  • d3cfsb_ is new in SCOPe 2.08-stable