Lineage for d3b7ka2 (3b7k A:179-298)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944410Species Human (Homo sapiens) [TaxId:9606] [255571] (3 PDB entries)
  8. 2944426Domain d3b7ka2: 3b7k A:179-298 [413072]
    Other proteins in same PDB: d3b7ka3, d3b7kc3
    automated match to d4moca2
    complexed with coa

Details for d3b7ka2

PDB Entry: 3b7k (more details), 2.7 Å

PDB Description: human acyl-coenzyme a thioesterase 12
PDB Compounds: (A:) Acyl-coenzyme A thioesterase 12

SCOPe Domain Sequences for d3b7ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7ka2 d.38.1.0 (A:179-298) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgtsvqsielvlpphanhhgntfggqimawmetvatisasrlcwahpflksvdmfkfrgp
stvgdrlvftaivnntfqtcvevgvrveafdcqewaegrgrhinsafliynaaddkenli

SCOPe Domain Coordinates for d3b7ka2:

Click to download the PDB-style file with coordinates for d3b7ka2.
(The format of our PDB-style files is described here.)

Timeline for d3b7ka2:

  • d3b7ka2 is new in SCOPe 2.08-stable