Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255571] (3 PDB entries) |
Domain d3b7ka2: 3b7k A:179-298 [413072] Other proteins in same PDB: d3b7ka3, d3b7kc3 automated match to d4moca2 complexed with coa |
PDB Entry: 3b7k (more details), 2.7 Å
SCOPe Domain Sequences for d3b7ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7ka2 d.38.1.0 (A:179-298) automated matches {Human (Homo sapiens) [TaxId: 9606]} rgtsvqsielvlpphanhhgntfggqimawmetvatisasrlcwahpflksvdmfkfrgp stvgdrlvftaivnntfqtcvevgvrveafdcqewaegrgrhinsafliynaaddkenli
Timeline for d3b7ka2: