![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) ![]() contains a single copy of this fold and an extra beta-strand at the C-terminus |
![]() | Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins) Pfam PF00408 |
![]() | Protein Phosphoglucomutase [55959] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries) |
![]() | Domain d1jdya4: 1jdy A:421-561 [41307] Other proteins in same PDB: d1jdya1, d1jdya2, d1jdya3, d1jdyb1, d1jdyb2, d1jdyb3 complexed with cd, so4 |
PDB Entry: 1jdy (more details), 2.7 Å
SCOPe Domain Sequences for d1jdya4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdya4 d.129.2.1 (A:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis ialkvsqlqertgrtaptvit
Timeline for d1jdya4:
![]() Domains from other chains: (mouse over for more information) d1jdyb1, d1jdyb2, d1jdyb3, d1jdyb4 |