| Class b: All beta proteins [48724] (180 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
| Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
| Protein automated matches [190988] (51 species) not a true protein |
| Species Norwalk-like virus [TaxId:95340] [419833] (8 PDB entries) |
| Domain d3asta_: 3ast A: [413064] automated match to d5or7a_ complexed with na, npo; mutant |
PDB Entry: 3ast (more details), 1.4 Å
SCOPe Domain Sequences for d3asta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3asta_ b.121.4.0 (A:) automated matches {Norwalk-like virus [TaxId: 95340]}
tieqktraftvpniplqtlsnsrfpsliqgmilspdasqvvqfqngrclidgqllgttpa
tsgqlfrvrgkinqgartlnltevdgkpfmafdspapvgfpdfgkcdwhmrisktpnnts
sgdpmrsvsvqtnvqgfvphlgsiqfdevfnhptgdyigtiewisnpstppgtdinlwei
pdygsslsqaanlappvfppgfgealvyfvsafpgpnnrsapndvpcllpqeyithfvse
qaptmgdaallhyvdpdtnrnlgefklypggyltcvpngvgagpqqlplngvflfvswvs
rfyqlkpvgta
Timeline for d3asta_: