Lineage for d1c47b4 (1c47 B:421-561)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418216Fold d.129: TBP-like [55944] (7 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 418348Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 418349Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (3 proteins)
  6. 418356Protein Phosphoglucomutase [55959] (1 species)
  7. 418357Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries)
  8. 418363Domain d1c47b4: 1c47 B:421-561 [41306]
    Other proteins in same PDB: d1c47a1, d1c47a2, d1c47a3, d1c47b1, d1c47b2, d1c47b3
    complexed with cd, g16; mutant

Details for d1c47b4

PDB Entry: 1c47 (more details), 2.7 Å

PDB Description: binding driven structural changes in crystaline phosphoglucomutase associated with chemical reaction

SCOP Domain Sequences for d1c47b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c47b4 d.129.2.1 (B:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOP Domain Coordinates for d1c47b4:

Click to download the PDB-style file with coordinates for d1c47b4.
(The format of our PDB-style files is described here.)

Timeline for d1c47b4: