Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.129: TBP-like [55944] (7 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) contains a single copy of this fold and an extra beta-strand at the C-terminus |
Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (3 proteins) |
Protein Phosphoglucomutase [55959] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries) |
Domain d1c47b4: 1c47 B:421-561 [41306] Other proteins in same PDB: d1c47a1, d1c47a2, d1c47a3, d1c47b1, d1c47b2, d1c47b3 complexed with cd, g16; mutant |
PDB Entry: 1c47 (more details), 2.7 Å
SCOP Domain Sequences for d1c47b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c47b4 d.129.2.1 (B:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)} rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis ialkvsqlqertgrtaptvit
Timeline for d1c47b4:
View in 3D Domains from other chains: (mouse over for more information) d1c47a1, d1c47a2, d1c47a3, d1c47a4 |