Lineage for d1c47b4 (1c47 B:421-561)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.129: TBP-like [55944] (3 superfamilies) 
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) 
Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (1 protein) Protein Phosphoglucomutase, C-terminal domain [55959] (1 species) Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries) 
Domain d1c47b4: 1c47 B:421-561 [41306]
Other proteins in same PDB: d1c47a1, d1c47a2, d1c47a3, d1c47b1, d1c47b2, d1c47b3
Details for d1c47b4
PDB Entry: 1c47 (more details), 2.7 Å
PDB Description: binding driven structural changes in crystaline phosphoglucomutase associated with chemical reaction
SCOP Domain Sequences for d1c47b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c47b4 d.129.2.1 (B:421-561) Phosphoglucomutase, C-terminal domain {Rabbit (Oryctolagus cuniculus)}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit
SCOP Domain Coordinates for d1c47b4:
Click to download the PDB-style file with coordinates for d1c47b4.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c47b4:
- d1c47b4 appears in SCOP 1.57
- d1c47b4 appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1c47a1, d1c47a2, d1c47a3, d1c47a4 |
