SCOPe 2.08: Domain d2yetb_: 2yet B:

Lineage for d2yetb_ (2yet B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Thermoascus aurantiacus [TaxId:5087] [419830] (2 PDB entries)

8. Domain d2yetb_: 2yet B: [413036]
   automated match to d2vtca_
   complexed with ace, cu, gol, nag

Details for d2yetb_

PDB Entry: 2yet, 1.5 Å

PDB Description: thermoascus gh61 isozyme a

PDB Compounds: (B:) gh61 isozyme a

SCOPe Domain Sequences for d2yetb_:

Sequence; same for both SEQRES and ATOM records:

>d2yetb_ b.1.18.0 (B:) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
hgfvqnividgknyggylvnqypymsnppeviawsttatdlgfvdgtgyqtpdiichrga
kpgaltapvspggtvelqwtpwpdshhgpvinylapcngdcstvdktqleffkiaesgli
nddnppgiwasdnliaannswtvtipttiapgnyvlrheiialhsaqnqdgaqnypqcin
lqvtgggsdnpagtlgtalyhdtdpgiliniyqklssyiipgpplyt

Timeline for d2yetb_:

• d2yetb_ is new in SCOPe 2.08-stable