Lineage for d2yeta_ (2yet A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766562Species Thermoascus aurantiacus [TaxId:5087] [419830] (2 PDB entries)
  8. 2766564Domain d2yeta_: 2yet A: [413035]
    automated match to d2vtca_
    complexed with ace, cu, gol, nag

Details for d2yeta_

PDB Entry: 2yet (more details), 1.5 Å

PDB Description: thermoascus gh61 isozyme a
PDB Compounds: (A:) gh61 isozyme a

SCOPe Domain Sequences for d2yeta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yeta_ b.1.18.0 (A:) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
hgfvqnividgknyggylvnqypymsnppeviawsttatdlgfvdgtgyqtpdiichrga
kpgaltapvspggtvelqwtpwpdshhgpvinylapcngdcstvdktqleffkiaesgli
nddnppgiwasdnliaannswtvtipttiapgnyvlrheiialhsaqnqdgaqnypqcin
lqvtgggsdnpagtlgtalyhdtdpgiliniyqklssyiipgpplyt

SCOPe Domain Coordinates for d2yeta_:

Click to download the PDB-style file with coordinates for d2yeta_.
(The format of our PDB-style files is described here.)

Timeline for d2yeta_:

  • d2yeta_ is new in SCOPe 2.08-stable