Lineage for d1vkla4 (1vkl A:421-561)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926327Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 1926328Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 1926338Protein Phosphoglucomutase [55959] (1 species)
  7. 1926339Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries)
  8. 1926342Domain d1vkla4: 1vkl A:421-561 [41303]
    Other proteins in same PDB: d1vkla1, d1vkla2, d1vkla3, d1vklb1, d1vklb2, d1vklb3
    complexed with ni

Details for d1vkla4

PDB Entry: 1vkl (more details), 2.7 Å

PDB Description: rabbit muscle phosphoglucomutase
PDB Compounds: (A:) phosphoglucomutase

SCOPe Domain Sequences for d1vkla4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkla4 d.129.2.1 (A:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOPe Domain Coordinates for d1vkla4:

Click to download the PDB-style file with coordinates for d1vkla4.
(The format of our PDB-style files is described here.)

Timeline for d1vkla4: