Lineage for d2xvga3 (2xvg A:413-788)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832243Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (6 proteins)
    Pfam PF01055
  6. 2832247Protein Catalytic domain of alpha-xylosidase [419127] (1 species)
  7. 2832248Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419647] (3 PDB entries)
  8. 2832250Domain d2xvga3: 2xvg A:413-788 [413020]
    Other proteins in same PDB: d2xvga1, d2xvga2, d2xvga4, d2xvga5, d2xvga6
    complexed with cl, edo, ni, so4

Details for d2xvga3

PDB Entry: 2xvg (more details), 2.6 Å

PDB Description: crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus
PDB Compounds: (A:) alpha xylosidase

SCOPe Domain Sequences for d2xvga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvga3 c.1.8.13 (A:413-788) Catalytic domain of alpha-xylosidase {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
kddiisgyrqltgksvmlpkwaygfwqsrerykssdeiiqnlkeyrdrkipidnivldws
ywpedawgshdfdkqffpdpkalvdkvhamnaqimisvwpkfypttdnykelnakgfmfn
rnldeknldwigkgylnafydpfspeataifwkqirdkinvhgfdawwldavepdihsnl
tfekrkwlmtpnargngaeifnayavphaegvyqgelatdgdkrsfiltrsgfggiqrtg
saiwsgdivsrwsdmkdqiaagigtnlagvtnwtfdiggftpedrfrhgkkgfvgswtal
daeqvdewqelntrwyqfgafvplyrshgqnpyreifniadegtevynamvwytklryyl
mpyiytlggdtyhkdg

SCOPe Domain Coordinates for d2xvga3:

Click to download the PDB-style file with coordinates for d2xvga3.
(The format of our PDB-style files is described here.)

Timeline for d2xvga3:

  • d2xvga3 is new in SCOPe 2.08-stable