Lineage for d3pmgb4 (3pmg B:421-561)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975429Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2975430Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 2975440Protein Phosphoglucomutase [55959] (1 species)
  7. 2975441Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries)
  8. 2975451Domain d3pmgb4: 3pmg B:421-561 [41302]
    Other proteins in same PDB: d3pmga1, d3pmga2, d3pmga3, d3pmgb1, d3pmgb2, d3pmgb3
    complexed with mg

Details for d3pmgb4

PDB Entry: 3pmg (more details), 2.4 Å

PDB Description: structure of rabbit muscle phosphoglucomutase at 2.4 angstroms resolution. use of freezing point depressant and reduced temperature to enhance diffractivity
PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d3pmgb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmgb4 d.129.2.1 (B:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOPe Domain Coordinates for d3pmgb4:

Click to download the PDB-style file with coordinates for d3pmgb4.
(The format of our PDB-style files is described here.)

Timeline for d3pmgb4: