Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) contains a single copy of this fold and an extra beta-strand at the C-terminus |
Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins) Pfam PF00408 |
Protein Phosphoglucomutase [55959] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries) |
Domain d3pmgb4: 3pmg B:421-561 [41302] Other proteins in same PDB: d3pmga1, d3pmga2, d3pmga3, d3pmgb1, d3pmgb2, d3pmgb3 complexed with mg |
PDB Entry: 3pmg (more details), 2.4 Å
SCOPe Domain Sequences for d3pmgb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmgb4 d.129.2.1 (B:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis ialkvsqlqertgrtaptvit
Timeline for d3pmgb4:
View in 3D Domains from other chains: (mouse over for more information) d3pmga1, d3pmga2, d3pmga3, d3pmga4 |