Lineage for d2xvga2 (2xvg A:238-386)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825681Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2825682Superfamily b.179.1: PA14-like [254123] (4 families) (S)
  5. 2825750Family b.179.1.3: Glycoside hydrolase family 31 (GH31), PA14-like domain [418815] (1 protein)
  6. 2825751Protein Alpha-xylosidase [419126] (1 species)
  7. 2825752Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419644] (3 PDB entries)
  8. 2825754Domain d2xvga2: 2xvg A:238-386 [413019]
    Other proteins in same PDB: d2xvga1, d2xvga3, d2xvga4, d2xvga5, d2xvga6
    complexed with cl, edo, ni, so4

Details for d2xvga2

PDB Entry: 2xvg (more details), 2.6 Å

PDB Description: crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus
PDB Compounds: (A:) alpha xylosidase

SCOPe Domain Sequences for d2xvga2:

Sequence, based on SEQRES records: (download)

>d2xvga2 b.179.1.3 (A:238-386) Alpha-xylosidase {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
aqplnqslklydaegkeggltvryfvgdelkltrveadfnhqfykqgnelenpfpeevag
ayknntlrielegsieaqatgkhqfkmynsgyaqlsldgevvldrwrmnwnpwyhnfyre
lnagdkhklkvswkpdggffhlrhldplp

Sequence, based on observed residues (ATOM records): (download)

>d2xvga2 b.179.1.3 (A:238-386) Alpha-xylosidase {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
aqplnqslklydaegkegltvryfvgdelkltrveadfnhqfykqgnelenpfpeevaga
yknntlrielegsieaqatgkhqfkmynsgyaqlsldgevvldrwrmnwnpwyhnfyrel
nagdkhklkvswkpdggffhlrhldplp

SCOPe Domain Coordinates for d2xvga2:

Click to download the PDB-style file with coordinates for d2xvga2.
(The format of our PDB-style files is described here.)

Timeline for d2xvga2:

  • d2xvga2 is new in SCOPe 2.08-stable