![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (5 proteins) Pfam PF16863 |
![]() | Protein Alpha-xylosidase [419125] (1 species) |
![]() | Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419643] (3 PDB entries) |
![]() | Domain d2xvga1: 2xvg A:45-237,A:387-412 [413018] Other proteins in same PDB: d2xvga2, d2xvga3, d2xvga4, d2xvga5, d2xvga6 complexed with cl, edo, ni, so4 |
PDB Entry: 2xvg (more details), 2.6 Å
SCOPe Domain Sequences for d2xvga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xvga1 b.30.5.11 (A:45-237,A:387-412) Alpha-xylosidase {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} alaqvertaegvvltlpegtvkklrlqvmgeriirvtalpgtdfgivpesiqvvakpatn vpfsvdqageklvlktsqvsaevslldgtvsfrdakgnvllqeenrgtfspvihdpdpvd adsyalrqefnrgsdegffglgqhqngqvnyagenvelttynlvisipflvssrnygllw dnnsitrfgdpreXaneqhelslasetgkaidyyfvagdt
Timeline for d2xvga1: