SCOPe 2.08: Domain d2wwua_: 2wwu A:

Lineage for d2wwua_ (2wwu A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins)
   Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
   Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811)

6. Protein PHD finger protein 8 (PHF8) [419131] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419653] (1 PDB entry)

8. Domain d2wwua_: 2wwu A: [413008]
   complexed with act, bgc, ni, so4

Details for d2wwua_

PDB Entry: 2wwu, 2.15 Å

PDB Description: crystal structure of the catalytic domain of phd finger protein 8

PDB Compounds: (A:) phd finger protein 8

SCOPe Domain Sequences for d2wwua_:

Sequence; same for both SEQRES and ATOM records:

>d2wwua_ b.82.2.14 (A:) PHD finger protein 8 (PHF8) {Human (Homo sapiens) [TaxId: 9606]}
vktgsptfvrelrsrtfdssdevilkptgnqltvefleensfsvpilvlkkdglgmtlps
psftvrdvehyvgsdkeidvidvtrqadckmklgdfvkyyysgkrekvlnvislefsdtr
lsnlvetpkivrklswvenlwpeecvferpnvqkyclmsvrdsytdfhidfggtsvwyhv
lkgekifylirptnanltlfecwssssnqnemffgdqvdkcykcsvkqgqtlfiptgwih
avltpvdclafggnflhslniemqlkayeiekrlstadlfrfpnfeticwyvgkhildif
rglrenrrhpasylvhggkalnlafrawtrkealpdhedeipetvrtvqlikdlareirl
ved

Timeline for d2wwua_:

• d2wwua_ is new in SCOPe 2.08-stable