Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins) contains a single copy of this fold |
Protein 8-oxoguanine glycosylase [55955] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries) |
Domain d1ebma2: 1ebm A:9-135 [41300] Other proteins in same PDB: d1ebma1 protein/DNA complex; complexed with ca |
PDB Entry: 1ebm (more details), 2.1 Å
SCOPe Domain Sequences for d1ebma2:
Sequence, based on SEQRES records: (download)
>d1ebma2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq gvrllrq
>d1ebma2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr llrq
Timeline for d1ebma2: