Lineage for d1ebma2 (1ebm A:9-135)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214643Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2214755Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
    contains a single copy of this fold
  6. 2214796Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 2214797Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)
  8. 2214804Domain d1ebma2: 1ebm A:9-135 [41300]
    Other proteins in same PDB: d1ebma1
    protein/DNA complex; complexed with ca

Details for d1ebma2

PDB Entry: 1ebm (more details), 2.1 Å

PDB Description: crystal structure of the human 8-oxoguanine glycosylase (hogg1) bound to a substrate oligonucleotide
PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOPe Domain Sequences for d1ebma2:

Sequence, based on SEQRES records: (download)

>d1ebma2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrq

Sequence, based on observed residues (ATOM records): (download)

>d1ebma2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

SCOPe Domain Coordinates for d1ebma2:

Click to download the PDB-style file with coordinates for d1ebma2.
(The format of our PDB-style files is described here.)

Timeline for d1ebma2: