Lineage for d1dizb2 (1diz B:1-99)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35720Fold d.129: TBP-like [55944] (3 superfamilies)
  4. 35721Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 35812Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
  6. 35813Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [55953] (1 species)
  7. 35814Species Escherichia coli [TaxId:562] [55954] (2 PDB entries)
  8. 35818Domain d1dizb2: 1diz B:1-99 [41299]
    Other proteins in same PDB: d1diza1, d1dizb1

Details for d1dizb2

PDB Entry: 1diz (more details), 2.5 Å

PDB Description: crystal structure of e. coli 3-methyladenine dna glycosylase (alka) complexed with dna

SCOP Domain Sequences for d1dizb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dizb2 d.129.1.2 (B:1-99) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli}
mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlg

SCOP Domain Coordinates for d1dizb2:

Click to download the PDB-style file with coordinates for d1dizb2.
(The format of our PDB-style files is described here.)

Timeline for d1dizb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dizb1