![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) ![]() |
![]() | Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins) contains a single copy of this fold |
![]() | Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [55953] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55954] (11 PDB entries) Uniprot P04395 |
![]() | Domain d1dizb2: 1diz B:1-99 [41299] Other proteins in same PDB: d1diza1, d1dizb1 protein/DNA complex; complexed with na |
PDB Entry: 1diz (more details), 2.5 Å
SCOPe Domain Sequences for d1dizb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dizb2 d.129.1.2 (B:1-99) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]} mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlg
Timeline for d1dizb2: