Lineage for d1diza2 (1diz A:1-99)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872516Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 872628Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
    contains a single copy of this fold
  6. 872629Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [55953] (1 species)
  7. 872630Species Escherichia coli [TaxId:562] [55954] (11 PDB entries)
    Uniprot P04395
  8. 872659Domain d1diza2: 1diz A:1-99 [41298]
    Other proteins in same PDB: d1diza1, d1dizb1

Details for d1diza2

PDB Entry: 1diz (more details), 2.5 Å

PDB Description: crystal structure of e. coli 3-methyladenine dna glycosylase (alka) complexed with dna
PDB Compounds: (A:) 3-methyladenine DNA glycosylase II

SCOP Domain Sequences for d1diza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diza2 d.129.1.2 (A:1-99) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlg

SCOP Domain Coordinates for d1diza2:

Click to download the PDB-style file with coordinates for d1diza2.
(The format of our PDB-style files is described here.)

Timeline for d1diza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1diza1