Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [187193] (9 PDB entries) |
Domain d2vt3b1: 2vt3 B:7-82 [412972] Other proteins in same PDB: d2vt3a2, d2vt3b2 automated match to d2dt5a1 complexed with atp |
PDB Entry: 2vt3 (more details), 2 Å
SCOPe Domain Sequences for d2vt3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vt3b1 a.4.5.0 (B:7-82) automated matches {Bacillus subtilis [TaxId: 1423]} kipqatakrlplyyrflknlhasgkqrvssaelsdavkvdsatirrdfsyfgalgkkgyg ynvdyllsffrktldq
Timeline for d2vt3b1: