Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries) |
Domain d2vt3a2: 2vt3 A:87-209 [412971] Other proteins in same PDB: d2vt3a1, d2vt3b1 automated match to d2dt5a2 complexed with atp |
PDB Entry: 2vt3 (more details), 2 Å
SCOPe Domain Sequences for d2vt3a2:
Sequence, based on SEQRES records: (download)
>d2vt3a2 c.2.1.0 (A:87-209) automated matches {Bacillus subtilis [TaxId: 1423]} dviligvgnlgtaflhynftknnntkismafdineskigtevggvpvynlddleqhvkde svailtvpavaaqsitdrlvalgikgilnftparlnvpehirihhidlavelqslvyflk hys
>d2vt3a2 c.2.1.0 (A:87-209) automated matches {Bacillus subtilis [TaxId: 1423]} dviligvgnlgtaflhyntkismafdineskigtevggvpvynlddleqhvkdesvailt vpavaaqsitdrlvalgikgilnftparlnvpehirihhidlavelqslvyflkhys
Timeline for d2vt3a2: