SCOPe 2.08: Domain d2vt3a2: 2vt3 A:87-209

Lineage for d2vt3a2 (2vt3 A:87-209)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries)

8. Domain d2vt3a2: 2vt3 A:87-209 [412971]
   Other proteins in same PDB: d2vt3a1, d2vt3b1
   automated match to d2dt5a2
   complexed with atp

Details for d2vt3a2

PDB Entry: 2vt3, 2 Å

PDB Description: structure and functional properties of the bacillus subtilis transcriptional repressor rex

PDB Compounds: (A:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d2vt3a2:

Sequence, based on SEQRES records:

>d2vt3a2 c.2.1.0 (A:87-209) automated matches {Bacillus subtilis [TaxId: 1423]}
dviligvgnlgtaflhynftknnntkismafdineskigtevggvpvynlddleqhvkde
svailtvpavaaqsitdrlvalgikgilnftparlnvpehirihhidlavelqslvyflk
hys

Sequence, based on observed residues (ATOM records):

>d2vt3a2 c.2.1.0 (A:87-209) automated matches {Bacillus subtilis [TaxId: 1423]}
dviligvgnlgtaflhyntkismafdineskigtevggvpvynlddleqhvkdesvailt
vpavaaqsitdrlvalgikgilnftparlnvpehirihhidlavelqslvyflkhys

Timeline for d2vt3a2:

• d2vt3a2 is new in SCOPe 2.08-stable