SCOPe 2.08: Domain d2vt3a1: 2vt3 A:11-83

Lineage for d2vt3a1 (2vt3 A:11-83)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187193] (9 PDB entries)

8. Domain d2vt3a1: 2vt3 A:11-83 [412970]
   Other proteins in same PDB: d2vt3a2, d2vt3b2
   automated match to d2dt5a1
   complexed with atp

Details for d2vt3a1

PDB Entry: 2vt3, 2 Å

PDB Description: structure and functional properties of the bacillus subtilis transcriptional repressor rex

PDB Compounds: (A:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d2vt3a1:

Sequence, based on SEQRES records:

>d2vt3a1 a.4.5.0 (A:11-83) automated matches {Bacillus subtilis [TaxId: 1423]}
atakrlplyyrflknlhasgkqrvssaelsdavkvdsatirrdfsyfgalgkkgygynvd
yllsffrktldqd

Sequence, based on observed residues (ATOM records):

>d2vt3a1 a.4.5.0 (A:11-83) automated matches {Bacillus subtilis [TaxId: 1423]}
atakrlplyyrflknlhasgkqrvssaelsdavkvdsatirrdfsyfgalgynvdyllsf
frktldqd

Timeline for d2vt3a1:

• d2vt3a1 is new in SCOPe 2.08-stable