SCOPe 2.08: Domain d2vt2b1: 2vt2 B:7-82

Lineage for d2vt2b1 (2vt2 B:7-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187193] (9 PDB entries)

8. Domain d2vt2b1: 2vt2 B:7-82 [412968]
   Other proteins in same PDB: d2vt2a2, d2vt2b2
   automated match to d2dt5a1
   complexed with nad

Details for d2vt2b1

PDB Entry: 2vt2, 2.3 Å

PDB Description: structure and functional properties of the bacillus subtilis transcriptional repressor rex

PDB Compounds: (B:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d2vt2b1:

Sequence, based on SEQRES records:

>d2vt2b1 a.4.5.0 (B:7-82) automated matches {Bacillus subtilis [TaxId: 1423]}
kipqatakrlplyyrflknlhasgkqrvssaelsdavkvdsatirrdfsyfgalgkkgyg
ynvdyllsffrktldq

Sequence, based on observed residues (ATOM records):

>d2vt2b1 a.4.5.0 (B:7-82) automated matches {Bacillus subtilis [TaxId: 1423]}
kipqatakrlplyyrflknlhasgkqrvssaelsdavkvdsatirrdfsyfgalgkgynv
dyllsffrktldq

Timeline for d2vt2b1:

• d2vt2b1 is new in SCOPe 2.08-stable