Lineage for d1mpga2 (1mpg A:1-99)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83826Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 83827Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 83920Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
  6. 83921Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [55953] (1 species)
  7. 83922Species Escherichia coli [TaxId:562] [55954] (2 PDB entries)
  8. 83923Domain d1mpga2: 1mpg A:1-99 [41296]
    Other proteins in same PDB: d1mpga1, d1mpgb1

Details for d1mpga2

PDB Entry: 1mpg (more details), 1.8 Å

PDB Description: 3-methyladenine dna glycosylase ii from escherichia coli

SCOP Domain Sequences for d1mpga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpga2 d.129.1.2 (A:1-99) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli}
mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlg

SCOP Domain Coordinates for d1mpga2:

Click to download the PDB-style file with coordinates for d1mpga2.
(The format of our PDB-style files is described here.)

Timeline for d1mpga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mpga1