SCOPe 2.05: Domain d1pczb2: 1pcz B:93-184

Lineage for d1pczb2 (1pcz B:93-184)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Pyrococcus woesei [TaxId:2262] [55951] (3 PDB entries)

8. Domain d1pczb2: 1pcz B:93-184 [41295]

Details for d1pczb2

PDB Entry: 1pcz, 2.2 Å

PDB Description: structure of tata-binding protein

PDB Compounds: (B:) tata-binding protein

SCOPe Domain Sequences for d1pczb2:

Sequence; same for both SEQRES and ATOM records:

>d1pczb2 d.129.1.1 (B:93-184) TATA-box binding protein (TBP), C-terminal domain {Pyrococcus woesei [TaxId: 2262]}
kfkrapqidvqnmvfsgdigrefnldvvaltlpnceyepeqfpgviyrvkepksvillfs
sgkivcsgakseadaweavrkllreldkygll

Timeline for d1pczb2:

• d1pczb2 first appeared (with stable ids) in SCOP 1.55
  
• d1pczb2 appears in SCOPe 2.04
  
• d1pczb2 appears in SCOPe 2.06
  
• d1pczb2 appears in the current release, SCOPe 2.08