Lineage for d2qz2a_ (2qz2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780689Species Aspergillus niger [TaxId:5061] [371346] (2 PDB entries)
  8. 2780691Domain d2qz2a_: 2qz2 A: [412940]
    automated match to d6qe8a_
    complexed with na

Details for d2qz2a_

PDB Entry: 2qz2 (more details), 2.8 Å

PDB Description: crystal structure of a glycoside hydrolase family 11 xylanase from aspergillus niger in complex with xylopentaose
PDB Compounds: (A:) endo-1,4-beta-xylanase I

SCOPe Domain Sequences for d2qz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qz2a_ b.29.1.0 (A:) automated matches {Aspergillus niger [TaxId: 5061]}
saginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysa
sgsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtneps
itgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvvavaawsgagsasv
tis

SCOPe Domain Coordinates for d2qz2a_:

Click to download the PDB-style file with coordinates for d2qz2a_.
(The format of our PDB-style files is described here.)

Timeline for d2qz2a_:

  • d2qz2a_ is new in SCOPe 2.08-stable