Lineage for d1pcza1 (1pcz A:2-92)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431003Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1431004Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 1431005Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 1431050Species Pyrococcus woesei [TaxId:2262] [55951] (3 PDB entries)
  8. 1431055Domain d1pcza1: 1pcz A:2-92 [41292]

Details for d1pcza1

PDB Entry: 1pcz (more details), 2.2 Å

PDB Description: structure of tata-binding protein
PDB Compounds: (A:) tata-binding protein

SCOPe Domain Sequences for d1pcza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcza1 d.129.1.1 (A:2-92) TATA-box binding protein (TBP), C-terminal domain {Pyrococcus woesei [TaxId: 2262]}
vdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallifs
sgklvvtgaksvqdieravaklaqklksigv

SCOPe Domain Coordinates for d1pcza1:

Click to download the PDB-style file with coordinates for d1pcza1.
(The format of our PDB-style files is described here.)

Timeline for d1pcza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pcza2