Lineage for d1d3ua2 (1d3u A:93-181)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196532Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 196533Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 196534Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 196535Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 196587Species Archaeon Pyrococcus woesei [TaxId:2262] [55951] (3 PDB entries)
  8. 196591Domain d1d3ua2: 1d3u A:93-181 [41291]
    Other proteins in same PDB: d1d3ub1, d1d3ub2

Details for d1d3ua2

PDB Entry: 1d3u (more details), 2.4 Å

PDB Description: tata-binding protein/transcription factor (ii)b/bre+tata-box complex from pyrococcus woesei

SCOP Domain Sequences for d1d3ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3ua2 d.129.1.1 (A:93-181) TATA-box binding protein (TBP), C-terminal domain {Archaeon Pyrococcus woesei}
kfkrapqidvqnmvfsgdigrefnldvvaltlpnceyepeqfpgviyrvkepksvillfs
sgkivcsgakseadaweavrkllreldky

SCOP Domain Coordinates for d1d3ua2:

Click to download the PDB-style file with coordinates for d1d3ua2.
(The format of our PDB-style files is described here.)

Timeline for d1d3ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d3ua1