Lineage for d1aisa2 (1ais A:93-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2581739Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2581740Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2581741Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2581786Species Pyrococcus woesei [TaxId:2262] [55951] (3 PDB entries)
  8. 2581788Domain d1aisa2: 1ais A:93-181 [41289]
    Other proteins in same PDB: d1aisb1, d1aisb2
    protein/DNA complex

Details for d1aisa2

PDB Entry: 1ais (more details), 2.1 Å

PDB Description: tata-binding protein/transcription factor (ii)b/tata-box complex from pyrococcus woesei
PDB Compounds: (A:) protein (tata-binding protein)

SCOPe Domain Sequences for d1aisa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aisa2 d.129.1.1 (A:93-181) TATA-box binding protein (TBP), C-terminal domain {Pyrococcus woesei [TaxId: 2262]}
kfkrapqidvqnmvfsgdigrefnldvvaltlpnceyepeqfpgviyrvkepksvillfs
sgkivcsgakseadaweavrkllreldky

SCOPe Domain Coordinates for d1aisa2:

Click to download the PDB-style file with coordinates for d1aisa2.
(The format of our PDB-style files is described here.)

Timeline for d1aisa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aisa1