SCOP 1.59: Domain d1aisa2: 1ais A:93-181

Lineage for d1aisa2 (1ais A:93-181)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)

7. Species Archaeon Pyrococcus woesei [TaxId:2262] [55951] (3 PDB entries)

8. Domain d1aisa2: 1ais A:93-181 [41289]
   Other proteins in same PDB: d1aisb1, d1aisb2

Details for d1aisa2

PDB Entry: 1ais, 2.1 Å

PDB Description: tata-binding protein/transcription factor (ii)b/tata-box complex from pyrococcus woesei

SCOP Domain Sequences for d1aisa2:

Sequence; same for both SEQRES and ATOM records:

>d1aisa2 d.129.1.1 (A:93-181) TATA-box binding protein (TBP), C-terminal domain {Archaeon Pyrococcus woesei}
kfkrapqidvqnmvfsgdigrefnldvvaltlpnceyepeqfpgviyrvkepksvillfs
sgkivcsgakseadaweavrkllreldky

Timeline for d1aisa2:

• d1aisa2 first appeared (with stable ids) in SCOP 1.55
  
• d1aisa2 appears in SCOP 1.57
  
• d1aisa2 appears in SCOP 1.61
  
• d1aisa2 appears in the current release, SCOPe 2.08