SCOP 1.73: Domain d1tbab2: 1tba B:156-240

Lineage for d1tbab2 (1tba B:156-240)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)

8. Domain d1tbab2: 1tba B:156-240 [41287]
   Other proteins in same PDB: d1tbaa_

Details for d1tbab2

PDB Entry: 1tba

PDB Description: solution structure of a tbp-tafii230 complex: protein mimicry of the minor groove surface of the tata box unwound by tbp, nmr, 25 structures

PDB Compounds: (B:) Transcription initiation factor TFIID

SCOP Domain Sequences for d1tbab2:

Sequence; same for both SEQRES and ATOM records:

>d1tbab2 d.129.1.1 (B:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

Timeline for d1tbab2:

• d1tbab2 first appeared (with stable ids) in SCOP 1.55
  
• d1tbab2 appears in SCOP 1.71
  
• d1tbab2 appears in SCOP 1.75
  
• d1tbab2 appears in the current release, SCOPe 2.08