Lineage for d1tbab2 (1tba B:156-240)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262082Fold d.129: TBP-like [55944] (4 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 262083Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 262084Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 262085Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
    structure of the N-terminal domain is not known yet
  7. 262146Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (4 PDB entries)
  8. 262158Domain d1tbab2: 1tba B:156-240 [41287]
    Other proteins in same PDB: d1tbaa_

Details for d1tbab2

PDB Entry: 1tba (more details)

PDB Description: solution structure of a tbp-tafii230 complex: protein mimicry of the minor groove surface of the tata box unwound by tbp, nmr, 25 structures

SCOP Domain Sequences for d1tbab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbab2 d.129.1.1 (B:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

SCOP Domain Coordinates for d1tbab2:

Click to download the PDB-style file with coordinates for d1tbab2.
(The format of our PDB-style files is described here.)

Timeline for d1tbab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tbab1
View in 3D
Domains from other chains:
(mouse over for more information)
d1tbaa_