SCOPe 2.08: Domain d2hkea1: 2hke A:4-181

Lineage for d2hkea1 (2hke A:4-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (23 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [419813] (1 PDB entry)

8. Domain d2hkea1: 2hke A:4-181 [412868]
   Other proteins in same PDB: d2hkea2, d2hkeb2
   automated match to d6xr5a1
   complexed with so4

Details for d2hkea1

PDB Entry: 2hke, 1.8 Å

PDB Description: mevalonate diphosphate decarboxylase from trypanosoma brucei

PDB Compounds: (A:) Diphosphomevalonate decarboxylase, putative

SCOPe Domain Sequences for d2hkea1:

Sequence; same for both SEQRES and ATOM records:

>d2hkea1 d.14.1.0 (A:4-181) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
qcvtveapiniafikywgkreggetlilptndsfsitlsaspfrsktsvelrddietdtl
rlngtevdvgktprvqsmllhlrstcpeelknkkvnivsennfptaagmassasgycams
aalirafksttnvsmlarlgsgsacrsafggfviwnkgekpdgsdcvatqfvdethwp

Timeline for d2hkea1:

• d2hkea1 is new in SCOPe 2.08-stable