SCOPe 2.07: Domain d1tbab1: 1tba B:61-155

Lineage for d1tbab1 (1tba B:61-155)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)

8. Domain d1tbab1: 1tba B:61-155 [41286]
   Other proteins in same PDB: d1tbaa_

Details for d1tbab1

PDB Entry: 1tba

PDB Description: solution structure of a tbp-tafii230 complex: protein mimicry of the minor groove surface of the tata box unwound by tbp, nmr, 25 structures

PDB Compounds: (B:) Transcription initiation factor TFIID

SCOPe Domain Sequences for d1tbab1:

Sequence; same for both SEQRES and ATOM records:

>d1tbab1 d.129.1.1 (B:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdf

Timeline for d1tbab1:

• d1tbab1 first appeared (with stable ids) in SCOP 1.55
  
• d1tbab1 appears in SCOPe 2.06
  
• d1tbab1 appears in the current release, SCOPe 2.08