Lineage for d1tbab1 (1tba B:61-155)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35720Fold d.129: TBP-like [55944] (3 superfamilies)
  4. 35721Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 35722Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 35723Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 35775Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (4 PDB entries)
  8. 35786Domain d1tbab1: 1tba B:61-155 [41286]
    Other proteins in same PDB: d1tbaa_

Details for d1tbab1

PDB Entry: 1tba (more details)

PDB Description: solution structure of a tbp-tafii230 complex: protein mimicry of the minor groove surface of the tata box unwound by tbp, nmr, 25 structures

SCOP Domain Sequences for d1tbab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbab1 d.129.1.1 (B:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdf

SCOP Domain Coordinates for d1tbab1:

Click to download the PDB-style file with coordinates for d1tbab1.
(The format of our PDB-style files is described here.)

Timeline for d1tbab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tbab2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tbaa_