SCOPe 2.08: Domain d2h3bb2: 2h3b B:164-483

Lineage for d2h3bb2 (2h3b B:164-483)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins)
   automatically mapped to Pfam PF04095

6. Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [419580] (2 PDB entries)

8. Domain d2h3bb2: 2h3b B:164-483 [412859]
   Other proteins in same PDB: d2h3ba1, d2h3bb1
   automated match to d2h3ba2
   complexed with so4

Details for d2h3bb2

PDB Entry: 2h3b, 1.95 Å

PDB Description: crystal structure of mouse nicotinamide phosphoribosyltransferase/visfatin/pre-b cell colony enhancing factor 1

PDB Compounds: (B:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d2h3bb2:

Sequence; same for both SEQRES and ATOM records:

>d2h3bb2 c.1.17.2 (B:164-483) Nicotinate phosphoribosyltransferase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
nsreqkkilakylmetsgnldgleyklhdfgyrgvssqetagigasahlvnfkgtdtvag
ialikkyygtkdpvpgysvpaaehstitawgkdhekdafehivtqfssvpvsvvsdsydi
ynacekiwgedlrhlivsrsteapliirpdsgnpmdtvlkvldilgkkfpvtenskgykl
lppylrviqgdgvdintlqeivegmkqkkwsienvsfgsggallqkltrdllncsfkcsy
vvtnglgvnvfkdpvadpnkrskkgrlsmhrtpagnfvtleegkgdleeyghdllhtvfk
ngkvtksysfdevrknaqln

Timeline for d2h3bb2:

• d2h3bb2 is new in SCOPe 2.08-stable