Lineage for d2h3ba2 (2h3b A:164-480)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839666Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins)
    automatically mapped to Pfam PF04095
  6. 2839667Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (5 species)
  7. 2839676Species Mouse (Mus musculus) [TaxId:10090] [419580] (2 PDB entries)
  8. 2839677Domain d2h3ba2: 2h3b A:164-480 [412857]
    Other proteins in same PDB: d2h3ba1, d2h3bb1
    complexed with so4

Details for d2h3ba2

PDB Entry: 2h3b (more details), 1.95 Å

PDB Description: crystal structure of mouse nicotinamide phosphoribosyltransferase/visfatin/pre-b cell colony enhancing factor 1
PDB Compounds: (A:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d2h3ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3ba2 c.1.17.2 (A:164-480) Nicotinate phosphoribosyltransferase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
nsreqkkilakylmetsgnldgleyklhdfgyrgvssqetagigasahlvnfkgtdtvag
ialikkyygtkdpvpgysvpaaehstitawgkdhekdafehivtqfssvpvsvvsdsydi
ynacekiwgedlrhlivsrsteapliirpdsgnpmdtvlkvldilgkkfpvtenskgykl
lppylrviqgdgvdintlqeivegmkqkkwsienvsfgsggallqkltrdllncsfkcsy
vvtnglgvnvfkdpvadpnkrskkgrlsmhrtpagnfvtleegkgdleeyghdllhtvfk
ngkvtksysfdevrkna

SCOPe Domain Coordinates for d2h3ba2:

Click to download the PDB-style file with coordinates for d2h3ba2.
(The format of our PDB-style files is described here.)

Timeline for d2h3ba2:

  • d2h3ba2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2h3ba1