Lineage for d1tbpb2 (1tbp B:156-240)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1668834Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1668835Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 1668836Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 1668837Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)
  8. 1668851Domain d1tbpb2: 1tbp B:156-240 [41285]

Details for d1tbpb2

PDB Entry: 1tbp (more details), 2.6 Å

PDB Description: crystal structure of yeast tata-binding protein and model for interaction with dna
PDB Compounds: (B:) tata-binding protein

SCOPe Domain Sequences for d1tbpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbpb2 d.129.1.1 (B:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

SCOPe Domain Coordinates for d1tbpb2:

Click to download the PDB-style file with coordinates for d1tbpb2.
(The format of our PDB-style files is described here.)

Timeline for d1tbpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tbpb1