Lineage for d2gvga1 (2gvg A:9-163)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2944970Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) (S)
  5. 2945049Family d.41.2.0: automated matches [227168] (1 protein)
    not a true family
  6. 2945050Protein automated matches [226878] (11 species)
    not a true protein
  7. 2945066Species Human (Homo sapiens) [TaxId:9606] [419805] (63 PDB entries)
  8. 2945132Domain d2gvga1: 2gvg A:9-163 [412836]
    Other proteins in same PDB: d2gvga2, d2gvgb2, d2gvgc2, d2gvgd2, d2gvge2, d2gvgf2
    automated match to d2h3ba1
    complexed with nmn, po4

Details for d2gvga1

PDB Entry: 2gvg (more details), 2.2 Å

PDB Description: Crystal Structure of human NMPRTase and its complex with NMN
PDB Compounds: (A:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d2gvga1:

Sequence, based on SEQRES records: (download)

>d2gvga1 d.41.2.0 (A:9-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnillatdsykvthykqyppntskvysyfecrekktensklrkvkyeetvfyglqyilnk
ylkgkvvtkekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfviprg
nvlftventdpecywltnwietilvqswypitvat

Sequence, based on observed residues (ATOM records): (download)

>d2gvga1 d.41.2.0 (A:9-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnillatdsykvthykqyppntskvysyfecreyeetvfyglqyilnkylkgkvvtkeki
qeakdvykehfqddvfnekgwnyilekydghlpieikavpegfviprgnvlftventdpe
cywltnwietilvqswypitvat

SCOPe Domain Coordinates for d2gvga1:

Click to download the PDB-style file with coordinates for d2gvga1.
(The format of our PDB-style files is described here.)

Timeline for d2gvga1:

  • d2gvga1 is new in SCOPe 2.08-stable